PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_026953
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family SBP
Protein Properties Length: 970aa    MW: 107847 Da    PI: 6.892
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_026953genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP128.42.8e-40150227178
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                  +Cqve+C+adls+ak+yhrrhkvC+vhska+++lv++++qrfCqqCsrfh+l+efDe+krsCrrrLa+hn+rrrk+++
  DCAR_026953 150 VCQVEDCRADLSSAKDYHRRHKVCDVHSKANSALVKNVMQRFCQQCSRFHTLQEFDEGKRSCRRRLAGHNRRRRKTHP 227
                  6**************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.0E-32145212IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.12148225IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.79E-37149229IPR004333Transcription factor, SBP-box
PfamPF031104.2E-29151224IPR004333Transcription factor, SBP-box
Gene3DG3DSA:1.25.40.203.8E-8740847IPR020683Ankyrin repeat-containing domain
SuperFamilySSF484038.49E-8740848IPR020683Ankyrin repeat-containing domain
CDDcd002041.27E-8741849No hitNo description
PROSITE profilePS502978.587790850IPR020683Ankyrin repeat-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 970 aa     Download sequence    Send to blast
MEAKLRDKGP QIFGSDAKAV GKKKMEWDLN DWRWDGDMFR AAPLNSNPSD CRGKQLFPSG  60
SGMAPVVNLS NNSSSCSEET TNEREKRELE KRRRVVLVED EEMNDEVGSP SLTLGGQVYP  120
ITTEGDRENW VEKNGKKTKT ADGATPRRPV CQVEDCRADL SSAKDYHRRH KVCDVHSKAN  180
SALVKNVMQR FCQQCSRFHT LQEFDEGKRS CRRRLAGHNR RRRKTHPENA TNAVNSNEEQ  240
SSSYLLISLL RILSNVHSNS SDQTKDNDLL SQLLSSLASR AGTINQSNFH RQPNESQDLQ  300
DAAASIRTQG QSSSRPTGQS SAVPAYGLTQ KQENIDVAHD ENLMAQKSSA LIPMEGGVPA  360
KANLHTSVGR MKLCNIDLNN AYDDTEDCME NMEHFDAPVN VASHQDSHKA SPPQTSGNSG  420
STSTQSPSSS SEELLAWLAN TPTDIESYIR PGCIILTVYL RMENSSWEEL CCDLKSSLRK  480
LLDSSSDSFW KTGWIYTRVR HRIAFAYDGQ VLLDTHIPSE SDKNCKIISV KPLAVSVSEE  540
VKFLVKGYNI SSSNTRFLCA LEGKYLVQQD SSVLMDRDAS LSNHQEEMQS ISFSCSIPEV  600
IGRGFVEVED QSLSSSFFPF IVVEPDVCSE IRTLESIIEA SEAAIGVKGK TEKSEASTVA  660
LDFVHELGWL LHRNQLKFRL GLMDPYQDLF PFKRFRCIME FSLDHGWCAV VKKLLGILFG  720
GTVDAGEHSS VERAVLEIGL LHRAVRQNCR LMVEALLNYR PENVVDKAGS DRKQTVAGHY  780
LFRPDAVGPM GLTPLHIAAG KDGSESVLDA LTDDPQSVGI EAWKNSRDST GLTPYDYACQ  840
RGHHSYIHIV QTKIKKKSEN RQVVIDIPSS LLDFNKNSKA ADDLKSTKVG SLETEKYAMK  900
LAQKQCGLCD QKLVYGNFRT SLAFCRPALL SMVAIAAVCV CVALLFKSSP EVLYVFQPFR  960
WELVKYGSS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A7e-311502241084squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
19094KRRRV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002274934.10.0PREDICTED: squamosa promoter-binding-like protein 1
TrEMBLF6HE380.0F6HE38_VITVI; Putative uncharacterized protein
STRINGVIT_05s0020g00700.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA18712466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60030.10.0squamosa promoter-binding protein-like 12